PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do002432.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family TALE
Protein Properties Length: 312aa    MW: 34350.7 Da    PI: 6.0489
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do002432.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.41e-072622952154
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 k +yp+++++++L +++gL+ +q+ +WF N+R +
  Do002432.1 262 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 295
                 469*****************************87 PP

2ELK25.43.3e-09216237122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK +L++++++++ ++++E++
  Do002432.1 216 ELKIELKQGFKSRIEDVREEIL 237
                 9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.6E-155094IPR005540KNOX1
PfamPF037905.1E-145292IPR005540KNOX1
SMARTSM012565.6E-23105160IPR005541KNOX2
PfamPF037914.2E-18108159IPR005541KNOX2
PROSITE profilePS512139.132216236IPR005539ELK domain
PROSITE profilePS5007111.726236299IPR001356Homeobox domain
SuperFamilySSF466894.71E-16238302IPR009057Homeodomain-like
SMARTSM003891.9E-10238303IPR001356Homeobox domain
CDDcd000864.28E-12239300No hitNo description
Gene3DG3DSA:1.10.10.602.4E-25243302IPR009057Homeodomain-like
PfamPF059201.1E-17256295IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MQGGGGDQGG GMDMGVGSFG GGAECSSSSA TAAAAAAAAA AAAAEAEERQ LLKGEIAVHP  60
LCEQLVAAHV GCLRVATPID HLPLIDTQLA QSSGLLHSYA AHHRSFLSPH DKHDLDSFLA  120
QYLMLLCSFR EQLQQHVRVH AVEAVMACRE IEQSLQDLTG ATLEEGSGAT MSEDEDEPPM  180
LEGALDMGSD GHDMMGFGPL MPTDSERSLM ERVRQELKIE LKQGFKSRIE DVREEILRKR  240
RAGKLPGDTT SILKQWWQQH SKWPYPTEDD KAKLVEETGL QLKQINNWFI NQRKRNWHNN  300
SQTSTLKSKR KR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1292311RKRNWHNNSQTSTLKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9669070.0EU966907.1 Zea mays clone 298091 homeobox protein HD1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001150419.10.0homeobox protein HD1
SwissprotQ94LW30.0KNOS3_ORYSJ; Homeobox protein knotted-1-like 3
TrEMBLB6TPJ20.0B6TPJ2_MAIZE; Homeobox protein HD1
STRINGGRMZM2G159431_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-150KNOTTED-like homeobox of Arabidopsis thaliana 7